Format for LSI-Package-Board Interoperable design

IEC 63055:2016(E) defines a common interoperable format that will be used for the design of
a) large-scale integration (LSI),
b) packages for such LSI, and
c) printed circuit boards on which the packaged LSI are interconnected. Collectively, such designs are referred to as "LSI-Package-Board" (LPB) designs. The format provides a common way to specify information/data about the project management, netlists, components, design rules, and geometries used in LPB designs. This standard is published as a double logo IEC-IEEE standard.

General Information

Status
Published
Publication Date
07-Nov-2016
Current Stage
DELPUB - Deleted Publication
Start Date
11-Oct-2023
Completion Date
26-Oct-2025

Relations

Effective Date
05-Sep-2023

Overview

IEC 63055:2016 (IEEE Std 2401) defines a common, interoperable format for LSI–Package–Board (LPB) design. The standard establishes a shared way to describe project management data, netlists, components, design rules, and physical geometries for large-scale integration (LSI) devices, their packages, and the printed circuit boards (PCBs) that interconnect them. Published as a double‑logo IEC–IEEE standard, IEC 63055 promotes consistent data exchange across semiconductor, packaging, and PCB design domains.

Key topics and technical requirements

  • LPB format structure: A modular, tag/elements‑based format (examples in the standard include M‑Format, C‑Format, R‑Format, N‑Format, G‑Format) to represent modules, components, physical design, nets, and geometry.
  • Common elements: Header and global metadata for project management and consistent identification of design files.
  • Netlists and connectivity: Formal representation of nets and net attributes to support interoperability between IC, package, and board design tools.
  • Component and package descriptions: Standardized component records and padstack/part definitions to reduce ambiguity in component placement and interfaces.
  • Physical geometry and layer definitions: Layer, shape, board geometry, via and route descriptions to enable accurate transfer of manufacturing and layout data.
  • Design rules and constraints: Constraint rule elements for electrical and physical design requirements (clearance, routing, bondwire, etc.).
  • Verification & integrity: Annexes cover practical tooling topics such as XML encryption, MD5 checksum, and example use cases and test benches to validate format conformance.
  • Examples and usage guidance: Informative annexes provide sample files, design flow examples, and simulation/test bench guidance.

Practical applications

  • Exchange of design data among IC designers, package engineers, and PCB/layout teams
  • Enabling multi‑discipline co‑design (chip ↔ package ↔ board) and reducing translation errors
  • EDA tool interoperability and data handoff between CAD/EDA applications
  • Supporting manufacturability checks, simulation setups, test bench generation, and verification workflows
  • Standardizing interfaces for supply‑chain collaboration and outsourced manufacturing

Who should use this standard

  • EDA tool vendors and integrators implementing LPB import/export
  • Semiconductor design teams (LSI/IC designers)
  • Package and substrate designers
  • PCB/layout engineers and CAD teams
  • Manufacturers, test engineers, and systems integrators that consume cross‑domain design data
  • Standards and quality assurance teams seeking consistent data interchange

Keywords: IEC 63055, IEEE Std 2401, LPB format, LSI‑Package‑Board interoperable design, netlist exchange, PCB geometry, package design, design rules, EDA interoperability.

Standard

IEC 63055:2016 - Format for LSI-Package-Board Interoperable design

English language
194 pages
sale 15% off
Preview
sale 15% off
Preview

Frequently Asked Questions

IEC 63055:2016 is a standard published by the International Electrotechnical Commission (IEC). Its full title is "Format for LSI-Package-Board Interoperable design". This standard covers: IEC 63055:2016(E) defines a common interoperable format that will be used for the design of a) large-scale integration (LSI), b) packages for such LSI, and c) printed circuit boards on which the packaged LSI are interconnected. Collectively, such designs are referred to as "LSI-Package-Board" (LPB) designs. The format provides a common way to specify information/data about the project management, netlists, components, design rules, and geometries used in LPB designs. This standard is published as a double logo IEC-IEEE standard.

IEC 63055:2016(E) defines a common interoperable format that will be used for the design of a) large-scale integration (LSI), b) packages for such LSI, and c) printed circuit boards on which the packaged LSI are interconnected. Collectively, such designs are referred to as "LSI-Package-Board" (LPB) designs. The format provides a common way to specify information/data about the project management, netlists, components, design rules, and geometries used in LPB designs. This standard is published as a double logo IEC-IEEE standard.

IEC 63055:2016 is classified under the following ICS (International Classification for Standards) categories: 31.180 - Printed circuits and boards; 31.200 - Integrated circuits. Microelectronics; 35.060 - Languages used in information technology. The ICS classification helps identify the subject area and facilitates finding related standards.

IEC 63055:2016 has the following relationships with other standards: It is inter standard links to IEC 63055:2023. Understanding these relationships helps ensure you are using the most current and applicable version of the standard.

IEC 63055:2016 is available in PDF format for immediate download after purchase. The document can be added to your cart and obtained through the secure checkout process. Digital delivery ensures instant access to the complete standard document.

Standards Content (Sample)


IEC 63055 ®
Edition 1.0 2016-11

IEEE Std 2401
INTERNATIONAL
STANDARD
Format for LSI-Package-Board interoperable design

All rights reserved. IEEE is a registered trademark in the U.S. Patent & Trademark Office, owned by the Institute of
Electrical and Electronics Engineers, Inc. Unless otherwise specified, no part of this publication may be reproduced
or utilized in any form or by any means, electronic or mechanical, including photocopying and microfilm, without
permission in writing from the IEC Central Office. Any questions about IEEE copyright should be addressed to the

IEEE. Enquiries about obtaining additional rights to this publication and other information requests should be
addressed to the IEC or your local IEC member National Committee.

IEC Central Office Institute of Electrical and Electronics Engineers, Inc.
3, rue de Varembé 3 Park Avenue
CH-1211 Geneva 20 New York, NY 10016-5997
Switzerland United States of America
Tel.: +41 22 919 02 11 stds.info@ieee.org
Fax: +41 22 919 03 00 www.ieee.org
info@iec.ch
www.iec.ch
About the IEC
The International Electrotechnical Commission (IEC) is the leading global organization that prepares and publishes
International Standards for all electrical, electronic and related technologies.

About IEC publications
The technical content of IEC publications is kept under constant review by the IEC. Please make sure that you have the
latest edition, a corrigenda or an amendment might have been published.

IEC Catalogue - webstore.iec.ch/catalogue Electropedia - www.electropedia.org
The stand-alone application for consulting the entire The world's leading online dictionary of electronic and
bibliographical information on IEC International Standards, electrical terms containing 20 000 terms and definitions in
Technical Specifications, Technical Reports and other English and French, with equivalent terms in 15 additional
documents. Available for PC, Mac OS, Android Tablets and languages. Also known as the International Electrotechnical
iPad. Vocabulary (IEV) online.

IEC publications search - www.iec.ch/searchpub IEC Glossary - std.iec.ch/glossary
The advanced search enables to find IEC publications by a 65 000 electrotechnical terminology entries in English and
variety of criteria (reference number, text, technical French extracted from the Terms and Definitions clause of
committee,…). It also gives information on projects, replaced IEC publications issued since 2002. Some entries have been
and withdrawn publications. collected from earlier publications of IEC TC 37, 77, 86 and

CISPR.
IEC Just Published - webstore.iec.ch/justpublished

Stay up to date on all new IEC publications. Just Published IEC Customer Service Centre - webstore.iec.ch/csc
details all new publications released. Available online and If you wish to give us your feedback on this publication or
also once a month by email. need further assistance, please contact the Customer Service
Centre: csc@iec.ch.
IEC 63055 ®
Edition 1.0 2016-11
IEEE Std 2401™
INTERNATIONAL
STANDARD
Format for LSI-Package-Board interoperable design

INTERNATIONAL
ELECTROTECHNICAL
COMMISSION
ICS 31.180; 31.200; 35.060 ISBN 978-2-8322-3686-4

– i – IEEE Std 2401-2015
Contents
1. Overview . 1
1.1 Scope . 1
1.2 Purpose . 1
1.3 Key characteristics of the LSI-Package-Board Format . 1
1.4 Contents of this standard . 3
2. Normative references . 3
3. Definitions, acronyms, and abbreviations . 3
3.1 Definitions . 3
3.2 Acronyms and abbreviations . 6
4. Concept of the LPB Format . 8
4.1 Technical background . 8
4.2 Conventional design . 8
4.3 Common problems at the design site . 8
4.4 Concept of LPB interoperable design . 9
4.5 Value creation by LPB interoperable design . 9
4.6 LPB Format .10
4.7 Summary of LPB Format files .10
5. Language basics.16
6. Common elements in M-Format, C-Format, and R-Format .17
6.1 General .17
6.2 The

element .18
6.3 The element .19
7. M-Format.31
7.1 M-Format file structure.31
7.2 The element .31
7.3 The element .32
8. C-Format .36
8.1 C-Format file structure .36
8.2 The element .37
8.3 The element .82
9. R-Format .86
9.1 R-Format file structure .86
9.2 The element .86
9.3 The element .116
10. N-Format .122
10.1 Purpose of the N-Format file .122
10.2 How to identify the power/ground network .122
10.3 Example .122
11. G-Format .122
11.1 Language basics of G-Format .122
11.2 Structure .123

IEEE Std 2401-2015 – ii –
11.3 Header section .124
11.4 Material section .125
11.5 Layer section.126
11.6 Shape section .126
11.7 Board geometry section .131
11.8 Padstack section .133
11.9 Part section .134
11.10 Component section .135
11.11 Net attribute section .136
11.12 Netlist section .136
11.13 Via section .138
11.14 Bondwire section .139
11.15 Route section .141
Annex A (informative) Bibliography .145
Annex B (informative) Examples of utilization .146
B.1 Understanding the function of the LPB Format .146
B.2 Test bench .146
B.3 Design flow example .148
B.4 Growth of the sample files in the LPB Format .179
B.5 Simulations using the sample files in the LPB Format .182
Annex C (informative) XML Encryption .184
Annex D (informative) MD5 checksum .187
Annex E (informative) Chip-Package Interface Protocol .188
E.1 General .188
E.2 Comparison of C-Format with Chip-Package Interface Protocol .188

Annex F (informative) IEEE list of participants .194

– iii – IEEE Std 2401-2015
FORMAT FOR LSI-PACKAGE-BOARD
INTEROPERABLE DESIGN
)25(:25'
  7KH,QWHUQDWLRQDO(OHFWURWHFKQLFDO&RPPLVVLRQ ,(& LVDZRUOGZLGHRUJDQL]DWLRQIRUVWDQGDUGL]DWLRQFRPSULVLQJ
DOO QDWLRQDO HOHFWURWHFKQLFDO FRPPLWWHHV ,(& 1DWLRQDO &RPPLWWHHV 7KHREMHFWRI,(&LVWRSURPRWH
LQWHUQDWLRQDOFRRSHUDWLRQRQDOOTXHVWLRQVFRQFHUQLQJVWDQGDUGL]DWLRQLQWKHHOHFWULFDODQGHOHFWURQLFILHOGV7R
WKLVHQGDQGLQDGGLWLRQWRRWKHUDFWLYLWLHV,(&SXEOLVKHV,QWHUQDWLRQDO6WDQGDUGV7HFKQLFDO6SHFLILFDWLRQV
7HFKQLFDO 5HSRUWV 3XEOLFO\ $YDLODEOH 6SHFLILFDWLRQV 3$6  DQG *XLGHV KHUHDIWHU UHIHUUHG WR DV ³,(&
3XEOLFDWLRQ V ´ 7KHLUSUHSDUDWLRQLVHQWUXVWHGWRWHFKQLFDOFRPPLWWHHVDQ\,(&1DWLRQDO&RPPLWWHHLQWHUHVWHG
LQ WKH VXEMHFW GHDOW ZLWK PD\ SDUWLFLSDWH LQ WKLV SUHSDUDWRU\ ZRUN ,QWHUQDWLRQDO JRYHUQPHQWDO DQG QRQ
JRYHUQPHQWDORUJDQL]DWLRQVOLDLVLQJZLWKWKH,(&DOVRSDUWLFLSDWHLQWKLVSUHSDUDWLRQ
,(((6WDQGDUGVGRFXPHQWVDUHGHYHORSHGZLWKLQ,(((6RFLHWLHVDQG6WDQGDUGV&RRUGLQDWLQJ&RPPLWWHHVRIWKH
,(((6WDQGDUGV$VVRFLDWLRQ ,(((6$ 6WDQGDUGV%RDUG,(((GHYHORSVLWVVWDQGDUGVWKURXJKDFRQVHQVXV
GHYHORSPHQWSURFHVVZKLFKEULQJVWRJHWKHUYROXQWHHUVUHSUHVHQWLQJYDULHGYLHZSRLQWVDQGLQWHUHVWVWRDFKLHYH
WKHILQDOSURGXFW9ROXQWHHUVDUHQRWQHFHVVDULO\PHPEHUVRI,(((DQGVHUYHZLWKRXWFRPSHQVDWLRQ:KLOH,(((
DGPLQLVWHUVWKHSURFHVVDQGHVWDEOLVKHVUXOHVWRSURPRWHIDLUQHVVLQWKHFRQVHQVXVGHYHORSPHQWSURFHVV,(((
GRHV QRW LQGHSHQGHQWO\ HYDOXDWH WHVW RU YHULI\ WKH DFFXUDF\ RI DQ\ RI WKH LQIRUPDWLRQ FRQWDLQHG LQ LWV
VWDQGDUGV8VHRI,(((6WDQGDUGVGRFXPHQWVLVZKROO\YROXQWDU\,(((GRFXPHQWVDUHPDGHDYDLODEOHIRUXVH
VXEMHFWWRLPSRUWDQWQRWLFHVDQGOHJDOGLVFODLPHUV VHHKWWSVWDQGDUGVLHHHRUJ,35GLVFODLPHUVKWPOIRUPRUH
LQIRUPDWLRQ 
,(&FROODERUDWHVFORVHO\ZLWK,(((LQDFFRUGDQFHZLWKFRQGLWLRQVGHWHUPLQHGE\DJUHHPHQWEHWZHHQWKHWZR
RUJDQL]DWLRQV
  7KHIRUPDOGHFLVLRQVRI,(&RQWHFKQLFDOPDWWHUVH[SUHVVDVQHDUO\DVSRVVLEOHDQLQWHUQDWLRQDOFRQVHQVXVRI
RSLQLRQRQWKHUHOHYDQWVXEMHFWVVLQFHHDFKWHFKQLFDOFRPPLWWHHKDVUHSUHVHQWDWLRQIURPDOOLQWHUHVWHG,(&
1DWLRQDO&RPPLWWHHV7KHIRUPDOGHFLVLRQVRI,(((RQWHFKQLFDOPDWWHUVRQFHFRQVHQVXVZLWKLQ,(((6RFLHWLHV
DQG6WDQGDUGV&RRUGLQDWLQJ&RPPLWWHHVKDVEHHQUHDFKHGLVGHWHUPLQHGE\DEDODQFHGEDOORWRIPDWHULDOO\
LQWHUHVWHG SDUWLHV ZKR LQGLFDWH LQWHUHVW LQ UHYLHZLQJ WKH SURSRVHG VWDQGDUG )LQDO DSSURYDO RI WKH ,(((
VWDQGDUGVGRFXPHQWLVJLYHQE\WKH,(((6WDQGDUGV$VVRFLDWLRQ ,(((6$ 6WDQGDUGV%RDUG
  ,(&,((( 3XEOLFDWLRQV KDYH WKH IRUP RI UHFRPPHQGDWLRQV IRU LQWHUQDWLRQDO XVH DQG DUH DFFHSWHG E\ ,(&
1DWLRQDO&RPPLWWHHV,(((6RFLHWLHVLQWKDWVHQVH:KLOHDOOUHDVRQDEOHHIIRUWVDUHPDGHWRHQVXUHWKDWWKH
WHFKQLFDOFRQWHQWRI,(&,(((3XEOLFDWLRQVLVDFFXUDWH,(&RU,(((FDQQRWEHKHOGUHVSRQVLEOHIRUWKHZD\LQ
ZKLFKWKH\DUHXVHGRUIRUDQ\PLVLQWHUSUHWDWLRQE\DQ\HQGXVHU
  ,QRUGHUWRSURPRWHLQWHUQDWLRQDOXQLIRUPLW\,(&1DWLRQDO&RPPLWWHHVXQGHUWDNHWRDSSO\,(&3XEOLFDWLRQV
LQFOXGLQJ,(&,(((3XEOLFDWLRQV WUDQVSDUHQWO\WRWKHPD[LPXPH[WHQWSRVVLEOHLQWKHLUQDWLRQDODQGUHJLRQDO
SXEOLFDWLRQV$Q\GLYHUJHQFHEHWZHHQDQ\,(&,(((3XEOLFDWLRQDQGWKHFRUUHVSRQGLQJQDWLRQDORUUHJLRQDO
SXEOLFDWLRQVKDOOEHFOHDUO\LQGLFDWHGLQWKHODWWHU
  ,(&DQG,(((GRQRWSURYLGHDQ\DWWHVWDWLRQRIFRQIRUPLW\,QGHSHQGHQWFHUWLILFDWLRQERGLHVSURYLGHFRQIRUPLW\
DVVHVVPHQWVHUYLFHVDQGLQVRPHDUHDVDFFHVVWR,(&PDUNVRIFRQIRUPLW\,(&DQG,(((DUHQRWUHVSRQVLEOH
IRUDQ\VHUYLFHVFDUULHGRXWE\LQGHSHQGHQWFHUWLILFDWLRQERGLHV
  $OOXVHUVVKRXOGHQVXUHWKDWWKH\KDYHWKHODWHVWHGLWLRQRIWKLVSXEOLFDWLRQ
  1ROLDELOLW\VKDOODWWDFKWR,(&RU,(((RUWKHLUGLUHFWRUVHPSOR\HHVVHUYDQWVRUDJHQWVLQFOXGLQJLQGLYLGXDO
H[SHUWVDQGPHPEHUVRIWHFKQLFDOFRPPLWWHHVDQG,(&1DWLRQDO&RPPLWWHHVRUYROXQWHHUVRI,(((6RFLHWLHV
DQGWKH6WDQGDUGV&RRUGLQDWLQJ&RPPLWWHHVRIWKH,(((6WDQGDUGV$VVRFLDWLRQ ,(((6$ 6WDQGDUGV%RDUG
IRUDQ\SHUVRQDOLQMXU\SURSHUW\GDPDJHRURWKHUGDPDJHRIDQ\QDWXUHZKDWVRHYHUZKHWKHUGLUHFWRULQGLUHFW
RUIRUFRVWV LQFOXGLQJOHJDOIHHV DQGH[SHQVHVDULVLQJRXWRIWKHSXEOLFDWLRQXVHRIRUUHOLDQFHXSRQWKLV
,(&,(((3XEOLFDWLRQRUDQ\RWKHU,(&RU,(((3XEOLFDWLRQV
  $WWHQWLRQLVGUDZQWRWKHQRUPDWLYHUHIHUHQFHVFLWHGLQWKLVSXEOLFDWLRQ8VHRIWKHUHIHUHQFHGSXEOLFDWLRQVLV
LQGLVSHQVDEOHIRUWKHFRUUHFWDSSOLFDWLRQRIWKLVSXEOLFDWLRQ
  $WWHQWLRQ LV GUDZQ WR WKH SRVVLELOLW\ WKDW LPSOHPHQWDWLRQ RI WKLV ,(&,((( 3XEOLFDWLRQ PD\ UHTXLUH XVH RI
PDWHULDOFRYHUHGE\SDWHQWULJKWV%\SXEOLFDWLRQRIWKLVVWDQGDUGQRSRVLWLRQLVWDNHQZLWKUHVSHFWWRWKH
H[LVWHQFHRUYDOLGLW\RIDQ\SDWHQWULJKWVLQFRQQHFWLRQWKHUHZLWK,(&RU,(((VKDOOQRWEHKHOGUHVSRQVLEOHIRU
LGHQWLI\LQJ(VVHQWLDO3DWHQW&ODLPVIRUZKLFKDOLFHQVHPD\EHUHTXLUHGIRUFRQGXFWLQJLQTXLULHVLQWRWKHOHJDO
YDOLGLW\ RU VFRSH RI 3DWHQW &ODLPV RU GHWHUPLQLQJ ZKHWKHU DQ\ OLFHQVLQJ WHUPV RU FRQGLWLRQV SURYLGHG LQ
FRQQHFWLRQZLWKVXEPLVVLRQRID/HWWHURI$VVXUDQFHLIDQ\RULQDQ\OLFHQVLQJDJUHHPHQWVDUHUHDVRQDEOHRU
QRQGLVFULPLQDWRU\8VHUVRIWKLVVWDQGDUGDUHH[SUHVVO\DGYLVHGWKDWGHWHUPLQDWLRQRIWKHYDOLGLW\RIDQ\SDWHQW
ULJKWVDQGWKHULVNRILQIULQJHPHQWRIVXFKULJKWVLVHQWLUHO\WKHLURZQUHVSRQVLELOLW\

IEEE Std 2401-2015 – iv –
,QWHUQDWLRQDO6WDQGDUG,(&,(((6WGKDVEHHQSURFHVVHGWKURXJK,(&WHFKQLFDO
FRPPLWWHH(OHFWURQLFVDVVHPEO\WHFKQRORJ\XQGHUWKH,(&,((('XDO/RJR$JUHHPHQW
7KHWH[WRIWKLVVWDQGDUGLVEDVHGRQWKHIROORZLQJGRFXPHQWV
,(((6WG )',6 5HSRUWRQYRWLQJ
   )',6 59'
)XOOLQIRUPDWLRQRQWKHYRWLQJIRUWKHDSSURYDORIWKLVVWDQGDUGFDQEHIRXQGLQWKHUHSRUWRQ
YRWLQJLQGLFDWHGLQWKHDERYHWDEOH
7KH,(&7HFKQLFDO&RPPLWWHHDQG,(((7HFKQLFDO&RPPLWWHHKDYHGHFLGHGWKDWWKHFRQWHQWV
RIWKLVSXEOLFDWLRQZLOOUHPDLQXQFKDQJHGXQWLOWKHVWDELOLW\GDWHLQGLFDWHGRQWKH,(&ZHEVLWH
XQGHUKWWSZHEVWRUHLHFFKLQWKHGDWDUHODWHGWRWKHVSHFLILFSXEOLFDWLRQ$WWKLVGDWHWKH
SXEOLFDWLRQZLOOEH
‡ UHFRQILUPHG
‡ ZLWKGUDZQ
‡ UHSODFHGE\DUHYLVHGHGLWLRQRU
‡ DPHQGHG

– v – IEEE Std 2401-2015
IEEE Std 2401-2015 – vi –
IEEE Standard Format
for LSI-Package-Board
Interoperable Design
Sponsor
Design Automation Standards Committee
of the
IEEE Computer Society
Approved 3 September 2015
IEEE-SA Standards Board
– vii – IEEE Std 2401-2015
Copyrights and Permissions
The following figures are reprinted with permission from JEITA
Figure i, Figure ii, Figure 1, Figure 3, Figure 16, Figure 17, Figure 18, Figure 19, Figure 20, Figure 21,
Figure 22, Figure 23, Figure 24, Figure 25, Figure 26, Figure 27, Figure 28, Figure 29, Figure 30,
Figure 31, Figure 32, Figure 33, Figure 34, Figure 35, Figure 36, Figure 37, Figure 38, Figure 39,
Figure 40, Figure 41, Figure 42, Figure 43, Figure 44, Figure 45, Figure 46, Figure 47, Figure 48,
Figure 49, Figure 50, Figure 51, Figure 60, Figure 61, Figure 62, Figure 63, Figure B.1, Figure B.3,
Figure B.5, Figure B.6, Figure B.7, Figure B.8, Figure B.10, Figure B.11, Figure B.12, Figure B.13,
Figure B.14, Figure B.15, Figure B.16, Figure B.17, Figure B.18, Figure B.19, Figure B.20, Figure B.21,
Figure B.22, Figure B.23, Figure B.24, Figure B.25, Figure B.26, Figure B.27, Figure B.28, Figure B.29

Abstract: A method is provided for specifying a common interoperable format for electronic
systems design. The format provides a common way to specify information/data about the project
management, netlists, components, design rules, and geometries used in Large-Scale Integrated
Circuit-Package-Board designs. The method provides the ability to make electronic systems a
key consideration early in the design process; design tools can use it to exchange
information/data seamlessly.
Keywords: common interoperable format, components, design analysis, design rules,
geometries, IEEE 2401™, large-scale integrated circuits, netlists, packages for LSI circuits,
printed circuit board, project management, Verilog-HDL
x
IEEE Std 2401-2015 – viii –
I(((,ntroduction
This introduction is not part of IEEE Std 2401™-2015, IEEE Standard Format for LSI-Package-Board Interoperable
Design.
To deal with the increasing difficulty of design and the cost competitiveness of the global market, and to
shorten the development term, innovative design methodologies should be implemented. It has been
difficult to achieve the optimization of an entire set of large-scale integrated (LSI) circuits, packages, and
board (LPB) using individual design processes for each LPB part.
One possibility for optimization is to have a certain section design the whole LPB; however, gathering
knowledge and integrating the design environment of each LPB part is difficult. Dedicated professional
technicians of individual LPB parts, who have the best knowledge and performance of their own part’s
design tools, intend to create design optimization by having proper interoperable information exchanges
among all LPB parties. In order to achieve a design that optimizes the balance between cost and
performance, information about and the results of design should be well shared among cooperating LPB
design sections.
The Japan Electronics and Information Technology Industries Association (JEITA) LPB Interoperable
Design Process Working Group (LPB-WG) was established to identify the solution. The LPB-WG intends
to make a standard for an exchange format to make it easy to exchange information between each of the
LPB design departments, so that optimal design will be carried out quickly.
The LPB interoperable design process has the following issues:
 Netlist not unified on each LPB
 Complexity of the representation of the relationship as a whole arrangement of the LPB
 Differences in how to give the design constraints, lack of design information, and many
discrepancies in design rules.
 Databases not unified in each LPB, or among different vendors
 No unified terms
Various problems caused by these issues include the following:
 A large effort is required for conversion of formats.
 The occurrence of conversion errors and connection errors is difficult to detect because there is a
lack of the information needed to do so.
 It takes a long time to gather information, resulting in a long period of design and analysis.
 It is difficult to make optimal design changes because the entire verification process is difficult.
 EDA tool cost increase because of additional development required to support multiple formats.
 It is time-consuming for designers to communicate their intentions in a way that others understand.
Based on this analysis, the LPB-WG has established an interface format that can address these issues.
As the one of the case studies of the LPB interoperable design process, the power distribution network
(PDN) should be designed with information about the other LPB parts to reduce the noise (see Figure i).

– ix – IEEE Std 2401-2015
Reprinted with permission from JEITA.
Figure i—Power distribution network
Resonance is caused by a capacitance and inductance present in the various parts in the LPB PDN.
Impedance at the resonant frequency will be extremely large. If each part of the overall LPB design is not
accurately simulated in the PDN model, the power supply circuit cannot be correctly designed (see
Figure ii).
Reprinted with permission from JEITA.
Figure ii—Example of PDN impedance
In order to run properly, this simulation should align a variety of information, such as the circuit model of
power distribution network (PDN) of LSI, shape information about the package and board, electrical
parameters of materials, and models of the components. It is difficult to make an efficient design when the
specification or format of the design information is different in each part of the LPB, and the necessary
parameters are not shared. When the format of the interface methods and models of the simulation are not
consistent, the setup time and the cost of design/verification are enormous, which has become a barrier to
cooperation in LPB design. The LPB-WG was established in JEITA to explore ways to create a mutual
LPB interface to enable a more efficient co-design environment.

IEEE Std 2401-2015 – 1 –
Format for LSI-Package-Board
Interoperable Design
IMPORTANT NOTICE: IEEE Standards documents are not intended to ensure safety, security, health,
or environmental protection, or ensure against interference with or from other devices or networks.
Implementers of IEEE Standards documents are responsible for determining and complying with all
appropriate safety, security, environmental, health, and interference protection practices and all
applicable laws and regulations.
This IEEE document is made available for use subject to important notices and legal disclaimers.
These notices and disclaimers appear in all publications containing this document and may
be found under the heading “Important Notice” or “Important Notices and Disclaimers
Concerning IEEE Documents.” They can also be obtained on request from IEEE or viewed at
http://standards.ieee.org/IPR/disclaimers.html.
1. Overview
1.1 Scope
This standard defines a common interoperable format that will be used for the design of a) large-scale
integration (LSI), b) packages for such LSI, and c) printed circuit boards on which the packaged LSI are
interconnected. Collectively, such designs are referred to as” LSI-Package-Board” (LPB) designs. The
format provides a common way to specify information/data about the project management, netlists,
components, design rules, and geometries used in LPB designs.
1.2 Purpose
The general purpose of this standard is to develop a common format that LPB design tools can use to
exchange information/data seamlessly, as opposed to having to work with multiple different input and
output formats.
1.3 Key characteristics of the LSI-Package-Board Format
LPB format will facilitate the exchange of design information. This functionality provides the ability to
plan the entire design at an early stage. In effect, post-design analysis will be possible throughout the entire

– 2 – IEEE Std 2401-2015
LPB design process. Analysis of each part of the design can be examined in relation to all other parts of the
design, to determine the optimal point to give feedback for appropriate design changes throughout the LPB.
This will promote the overall optimization of the design process.
The LPB Format is constructed out of the following five formats (see Figure 1):
a) Project Manage (M-Format)
b) Netlist (N-Format)
c) Component (C-Format)
d) Design Rule (R-Format)
e) Geometry (G-Format)
Reprinted with permission from JEITA.
Figure 1 —LPB Format
Design time can be shortened by using the LPB Format. Traditionally, design starts immediately after
separate planning for each individual component of the LPB. Therefore, information exchange among the
separate design processes is limited. Trying to adjust the detailed design of one component to the detailed
design of another component makes the entire design period take longer. Optimization also tends to be a
separate process for each component of the LPB. By using the LPB Format for distributing information,
each LPB technician will be able to have the same understanding of the challenges at an early stage. As a
result, adjustments at the conceptual design stage can be made, before detailed designs are developed. By
making clear the overall LPB product specifications, the design target can be decided, and so the duration
of individual designs can be shortened. Use of the LPB Format also helps to reduce the number of design
iterations, because the design quality is enhanced. The designers can collect all information for simulation

IEEE Std 2401-2015 – 3 –
using the LPB formats, thereby reducing production time. The LPB Format can enable the entire analysis
easily, so that sufficient verification can be done and the quality of the products can be improved. As a
result, the period of adjustment in the set can be shortened and the time to market can be accelerated. With
the LPB Format, the design method for one product can be applied to the design environment for next
product in development.
1.4 Contents of this standard
The organization of the remainder of this standard is as follows:
 Clause 2 provides references to other applicable standards that are presumed or required for this
standard.
 Clause 3 defines terms and acronyms used throughout the different specifications contained in this
standard.
 Clause 4 describes the concepts of the LPB Format.
 Clause 5 describes the language basics for the LPB Format and its commands.
 Clause 6 describes common elements in the M-Format, C-Format, and R-Format.
 Clause 7 describes the M-Format.
 Clause 8 describes the C-Format.
 Clause 9 describes the R-Format.
 Clause 10 describes the N-Format.
 Clause 11 describes the G-Format.
2. Normative references
The following referenced documents are indispensable for the application of this document (i.e., they must
be understood and used, so each referenced document is cited in text and its relationship to this document is
explained). For dated references, only the edition cited applies. For undated references, the latest edition of
the referenced document (including any amendments or corrigenda) applies.
1,2
IEEE Std 1364™, IEEE Standard for Verilog Hardware Description Language.
3. Definitions, acronyms, and abbreviations
3.1 Definitions
For the purposes of this document, the following terms and definitions apply. The IEEE Standards
Dictionary Online should be consulted for terms not defined in this clause.
IEEE publications are available from The Institute of Electrical and Electronics Engineers (http://standards.ieee.org/).
The IEEE standards or products referred to in this clause are trademarks of The Institute of Electrical and Electronics Engineers, Inc.
IEEE Standards Dictionary Online subscription is available at:
http://www.ieee.org/portal/innovate/products/standard/standards_dictionary.html.

– 4 – IEEE Std 2401-2015
antipad: The clearance hole between a via and a no-connect metal layer, mainly used on the printed circuit
board and LSI package. The shape of the antipad is mainly determined by the limit on the printed circuit
board or LSI package manufacturing and is defined by the padstack in the R-Format file.
ball grid array (BGA) package: A type of surface-mount package with one face covered (or partly
covered) with solder balls arranged in a grid pattern.
ball: See: solder ball.
board: The printed circuit board or printed wiring board.
bonding finger: The metal electrode on the surface of an LSI package. It connects the bonding wire to the
routing pattern on the LSI package. In LPB Format files, the shape of the bonding finger is defined by the
padstack in the C-Format file.
bonding wire: A metal wire for connecting the die and bonding finger. In LPB Format files, the shape of
the bonding wire is defined in the R-Format file.
clock: The signal used in a synchronous circuit. All synchronous circuits use a clock signal to synchronize
different parts of the circuit. In most cases, the part is register or flip-flop. The clock is distributed from a
single source to registers or flip-flops and is required to arrive at all such parts at the same time
common mode impedance: The impedance of a single transmission line when the two lines in a pair are
driven with signals of the same amplitude and same polarity. Common (even) and differential (odd) modes
are the two main modes of propagation of the signal through a coupled line pair.
component: A physical and logical construction having inputs to outputs. LSI package or semiconductor
chips and passive parts such as capacitors and connectors are called components.
component hole: A hole used for the attachment of component terminations to the printed board as well
as for any electrical connection to the conductive pattern. See also: hole.
delay: The time interval between a step function change of the input signal level and the instant at which
the magnitude of the output signal passes through a specified value that is close to its initial value.
The switching time of the transistor and the propagation time of the signal through wiring.
die: A separated part (or whole) of a wafer intended to perform a function or functions in a device.
A small block of semiconducting material, on which a given functional circuit is fabricated.
differential mode impedance: The impedance of a single transmission line when the two lines in a pair are
driven with signals of the same amplitude and opposite polarity. Common (even) and differential (odd)
modes are the two main modes of propagation of the signal through a coupled line pair.
differential signal: Differential signaling. A method of transmitting information electrically with two
complementary signals sent on two paired wires, called a differential pair.
drill: The drill to be used when drilling the via hole connecting the layers of a multilayer printed circuit
board.
driver: See: sender.
finger: See: bonding finger.
flipchip pad: The contact pad of the flipchip surface.

IEEE Std 2401-2015 – 5 –
flipchip: A chip that is flipped over so that its metal wiring faces down in order to mount the chip to
external circuitry (e.g., a circuit board or another chip or wafer).
guard shield: A barrier or enclosure provided for mechanical protection, which may also have the function
of a screen, called a “GND shield” when put on a ground (GND) conductor. Its purpose is to limit the
electromagnetic interference from other signals.
hole: Used for the conductive connection between each layers and for mounting components. See also:
component hole, landless hole, mounting hole, plated-through hole, and via hole.
inout: A port having the function of both input and output. It is an input port where electromagnetic
energy or signals may be received from an external circuit or device. It is an output port where
electromagnetic energy or signals may be supplied to an external circuit or device.
land: The conductive pattern used for joining and connecting parts, the conductive pattern for surface
mount pads and hole-mounted components, and the conductive pattern that covers a via hole.
landless hole: A plated-through hole without land. See also: hole.
line: A device connecting two points for the purpose of conveying electromagnetic energy between them.
Electromagnetic energy may be extracted from or supplied to a line at an intermediate point. Examples of
lines are two-wire line, polygon line, coaxial line, and waveguide.
mounting hole: A hole used for the mechanical mounting of a printed board or for mechanical attachment
of components to the printed board. See also: hole.
net: The relative position of the ideal elements representing an electric network. The label in between
interconnection of terminals. Although it is defined on the same hierarchy, there are also cases that indicate
the connection regardless of hierarchy (for example, global net/definition).
package mold: Protection of an LSI chip by resin against stress, external force, water, static electricity, and
foreign substances. A package mold contains resin, silica, carbon, and flame retardant material.
package substrate: The same as that of a printed circuit board. It carries LSI and electrically connects
solder balls with LSI.
package: An enclosure for one or more chips, film elements, or other components, that allows electrical
connection and provides mechanical and environmental protection. Types of packages include quad flat
package (QFP), ball-grid array (BGA), wafer-level chip-scale package (WLCSP), multi-chip module
(MCM), package on package (PoP), etc.
pad: A metal electrode on the surface of a semiconductor device, LSI package, or printed circuit board.
padstack: The combination of layers that constitute a pad.
physical design rule: A series of parameters provided by semiconductor manufacturers that enable the
designer to verify the correctness of a mask set. A design rule set specifies certain geometric and
connectivity restrictions to ensure sufficient margins to account for variability in semiconductor
manufacturing processes, so as to ensure that most of the parts work correctly.
pin: A contact element intended to make electric engagement on its outer surface for mating with the inner
surface of another contact element.
plated-through hole: A hole in which metal is deposited on the wall. See also: hole.

– 6 – IEEE Std 2401-2015
port: Access to a device or network where electromagnetic energy or signals may be supplied or received,
or where the device or network variables may be observed or measured.
NOTE—An example of a port is a terminal pair.
power domain: A collection of instances that are treated as a group for power-management purposes. The
instances of a power domain typically, but do not always, share a primary supply set. A power domain may
also have additional supplies, including retention and isolation supplies.
receiver: A device that receives signals for interpretation and action.
reference point: A point of reference that is used for representing the coordinates.
sender: A device that generates and terminates signals. Syn: driver.
single-ended signal: A signal used for single-ended signaling, which is the method of transmitting signals
over electrical connections. One electrical connection carries a varying voltage that represents the signal.
skew: A variation of a delay time by propagation of a signal, or an amount of gaps of the delay time
between a reference signal and an object signal.
solder ball: A spherical solder that is used in the LSI package of a BGA type and provides the contact
between the package and the printed circuit board. The pins of the BGA package are placed in a grid
pattern. Balls are mounted on each pin and used to solder the BGA to the printed circuit board. The internal
circuit in a BGA exchanges signals and power with an external circuit on a printed circuit board through
the ball. The shape of the ball is defined in the R-Format file.
stacked via: A structure that places a via on another via. See also: via.
sub-circuit: A sub-circuit expresses a specific circuit as one unit.
terminator: A device fitted to the end of a cable to ensure electrical connection with other parts of the
system and to maintain the insulation up to the point of connection.
typ: An abbreviation of “typical,” used to express a representative or standard value.
via hole: The conduction connectivity made through a hole in between layers. See also: hole.
via: One of the conductive parts forming a contact in between layers.
void: A hole or cutout on a plane.
3.2 Acronyms and abbreviations
ASCII American Standard Code for Information Interchange
BGA ball grid array
CPIP Chip-Package Interface Protocol
DC direct current
Notes in text, tables, and figures of a standard are given for information only and do not contain requirements needed to implement
this standard.
IEEE Std 2401-2015 – 7 –
DDR double data rate
DDR-SDRAM double data rate synchronous dynamic random-access memory
DEF Design Exchange Format
DXF Drawing Exchange Format
EDA electronic design automation
EMI electromagnetic interference
GDS (GDS II) Graphic Database System
GND ground
HDL hardware description language
ICEM integrated circuit emission model
ICIM integrated circuit immunity model
IEC International Electrotechnical Commission
I/O input output
IBIS Input/output Buffer Information Specification
IC integrated circuit
JEDEC Joint Electron Device Engineering Council
JEITA Japan Electronics and Information Technology Industries Association
LPB LSI, package, and board; LSI-Package-Board
LPB-WG LPB interoperable design process working group
LSI large-scale integration
MD5 message digest algorithm 5
NG no good
PCB printed-circuit-board (adjective)
PCIe Peripheral Component Interconnect Express
PKG package
PKI public key infrastructure
POP, PoP package on package
PWB printed wiring board
– 8 – IEEE Std 2401-2015
RMS root mean square
Si2 Silicon Integration Initiative
SMA subminiature version A
SoC System on Chip
SPICE Simulation Program with Integrated Circuit Emphasis
VHDL Very High Speed Integrated Circuits Hardware Description Language
XML Extensible Markup Language
Xtal crystal
4. Concept of the LPB Format
4.1 Technical background
The design margin for timing and noise is decreasing due to the higher speed of systems and the low
voltage of the interface and power supply. Also, balancing design for both cost and performance is
increasingly becoming important for cost competitiveness. In a conventional design, the LSI, package, and
board (LPB) are designed with margin in accordance with individual design guidelines. However, it
becomes difficult to provide design guidelines for each LPB part separately with the decreased design
margin. Therefore, deciding the design target needs the cooperation of the designers of each part of the
LPB. In other words, the innovation of deciding design guidelines by using simulation technology is
needed in the system design process. To perform this task, a rapid and accurate simulation environment is
necessary.
4.2 Conventional design
In conventional design, LPB design and sign-off
...

Questions, Comments and Discussion

Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.

Loading comments...