IEC 61636-1:2016
(Main)Software interface for maintenance information collection and analysis (SIMICA): Exchanging test results and session information via the extensible markup language (XML)
Software interface for maintenance information collection and analysis (SIMICA): Exchanging test results and session information via the extensible markup language (XML)
IEC 61636-1:2016(E) is the definition of an exchange format, utilizing XML, for exchanging data resulting from executing tests of a unit under test (UUT) via a test program in an automatic test environment. This standard is published as a double logo IEC-IEEE standard.
General Information
- Status
- Published
- Publication Date
- 07-Nov-2016
- Technical Committee
- TC 91 - Electronics assembly technology
- Current Stage
- DELPUB - Deleted Publication
- Start Date
- 08-Jun-2021
- Completion Date
- 14-Feb-2026
Relations
- Effective Date
- 05-Sep-2023
Overview
IEC 61636-1:2016 (also published as IEEE Std 1636.1-2013) defines a standardized XML exchange format for sharing test results and session information produced by automatic test systems (ATS). Part of the SIMICA (Software Interface for Maintenance Information Collection and Analysis) family, this double-logo IEC–IEEE standard specifies XML schemas and an information model to enable consistent capture, storage and exchange of test-history and session metadata for units under test (UUT).
Key topics and requirements
- XML schema definitions: The standard includes normative XML schemas (for example TestResults.xsd and TestResultsCollection.xsd) that define the structure for recording test outcomes and collections of test sessions.
- Information modeling: EXPRESS models and EXPRESS‑G diagrams are provided to describe the formal information model underpinning the XML schemas (see Annex B normative content).
- Test results and session information: Clause 4 focuses on the content needed to record execution history and observation data from automated test programs - including applicability and usage within ATS architectures.
- Conformance and extensibility: The document specifies conformance criteria and mechanisms for user extensibility so implementers can adapt the schema to additional use cases while preserving interoperability.
- Normative and informative annexes: Annex A contains the XML schemas; Annex B contains EXPRESS models; Annex C provides bibliography and implementation references.
Practical applications
- Interoperability between ATS components: Standardized XML enables different test equipment, databases and analysis tools to share test results without custom parsers.
- Data capture and analysis: Facilitates online and offline performance analysis, diagnostic maturation, post-production improvement and maintenance-process optimization.
- Storage and archival: Creates a consistent class of information for archival in databases or storage devices for later retrieval and analytics.
- Tool and system integration: Useful for ATE vendors, test-program developers, diagnostic tool providers, maintenance organizations and system integrators who need machine- and human-readable exchange formats.
Who should use this standard
- Maintenance organizations (defense, aviation, automotive, telecom)
- Automatic test equipment (ATE) manufacturers and integrators
- Data analysts, diagnostic software vendors and system architects
- Labs and service providers that capture, share or analyze test-session histories
Related standards
- IEEE Std 1636.1-2013 (identical double-logo publication)
- References to IEEE Std 1671 components where applicable (used by the schema)
IEC 61636-1:2016 (SIMICA) is a practical, XML-based interoperability standard that reduces integration effort for exchanging automated test results and session metadata across tools and organizations.
Buy Documents
IEC 61636-1:2016 - Software interface for maintenance information collection and analysis (SIMICA): Exchanging test results and session information via the extensible markup language (XML) Released:11/8/2016
Get Certified
Connect with accredited certification bodies for this standard

BSI Group
BSI (British Standards Institution) is the business standards company that helps organizations make excellence a habit.
National Aerospace and Defense Contractors Accreditation Program (NADCAP)
Global cooperative program for special process quality in aerospace.
CARES (UK Certification Authority for Reinforcing Steels)
UK certification for reinforcing steels and construction.
Sponsored listings
Frequently Asked Questions
IEC 61636-1:2016 is a standard published by the International Electrotechnical Commission (IEC). Its full title is "Software interface for maintenance information collection and analysis (SIMICA): Exchanging test results and session information via the extensible markup language (XML)". This standard covers: IEC 61636-1:2016(E) is the definition of an exchange format, utilizing XML, for exchanging data resulting from executing tests of a unit under test (UUT) via a test program in an automatic test environment. This standard is published as a double logo IEC-IEEE standard.
IEC 61636-1:2016(E) is the definition of an exchange format, utilizing XML, for exchanging data resulting from executing tests of a unit under test (UUT) via a test program in an automatic test environment. This standard is published as a double logo IEC-IEEE standard.
IEC 61636-1:2016 is classified under the following ICS (International Classification for Standards) categories: 25.040.01 - Industrial automation systems in general; 35.060 - Languages used in information technology. The ICS classification helps identify the subject area and facilitates finding related standards.
IEC 61636-1:2016 has the following relationships with other standards: It is inter standard links to IEC 61636-1:2021. Understanding these relationships helps ensure you are using the most current and applicable version of the standard.
IEC 61636-1:2016 is available in PDF format for immediate download after purchase. The document can be added to your cart and obtained through the secure checkout process. Digital delivery ensures instant access to the complete standard document.
Standards Content (Sample)
IEC 61636-1 ®
Edition 1.0 2016-11
™
IEEE Std 1636.1
INTERNATIONAL
STANDARD
Software interface for maintenance information collection and analysis (SIMICA):
Exchanging test results and session information via the extensible markup
language (XML)
All rights reserved. IEEE is a registered trademark in the U.S. Patent & Trademark Office, owned by the Institute of
Electrical and Electronics Engineers, Inc. Unless otherwise specified, no part of this publication may be reproduced
or utilized in any form or by any means, electronic or mechanical, including photocopying and microfilm, without
permission in writing from the IEC Central Office. Any questions about IEEE copyright should be addressed to the
IEEE. Enquiries about obtaining additional rights to this publication and other information requests should be
addressed to the IEC or your local IEC member National Committee.
IEC Central Office Institute of Electrical and Electronics Engineers, Inc.
3, rue de Varembé 3 Park Avenue
CH-1211 Geneva 20 New York, NY 10016-5997
Switzerland United States of America
Tel.: +41 22 919 02 11 stds.info@ieee.org
Fax: +41 22 919 03 00 www.ieee.org
info@iec.ch
www.iec.ch
About the IEC
The International Electrotechnical Commission (IEC) is the leading global organization that prepares and publishes
International Standards for all electrical, electronic and related technologies.
About IEC publications
The technical content of IEC publications is kept under constant review by the IEC. Please make sure that you have the
latest edition, a corrigenda or an amendment might have been published.
IEC Catalogue - webstore.iec.ch/catalogue Electropedia - www.electropedia.org
The stand-alone application for consulting the entire The world's leading online dictionary of electronic and
bibliographical information on IEC International Standards, electrical terms containing 20 000 terms and definitions in
Technical Specifications, Technical Reports and other English and French, with equivalent terms in 15 additional
documents. Available for PC, Mac OS, Android Tablets and languages. Also known as the International Electrotechnical
iPad. Vocabulary (IEV) online.
IEC publications search - www.iec.ch/searchpub IEC Glossary - std.iec.ch/glossary
The advanced search enables to find IEC publications by a 65 000 electrotechnical terminology entries in English and
variety of criteria (reference number, text, technical French extracted from the Terms and Definitions clause of
committee,…). It also gives information on projects, replaced IEC publications issued since 2002. Some entries have been
and withdrawn publications. collected from earlier publications of IEC TC 37, 77, 86 and
CISPR.
IEC Just Published - webstore.iec.ch/justpublished
Stay up to date on all new IEC publications. Just Published IEC Customer Service Centre - webstore.iec.ch/csc
details all new publications released. Available online and If you wish to give us your feedback on this publication or
also once a month by email. need further assistance, please contact the Customer Service
Centre: csc@iec.ch.
IEC 61636-1 ®
Edition 1.0 2016-11
IEEE Std 1636.1™
INTERNATIONAL
STANDARD
Software interface for maintenance information collection and analysis (SIMICA):
Exchanging test results and session information via the extensible markup
language (XML)
INTERNATIONAL
ELECTROTECHNICAL
COMMISSION
ICS 25.040.01; 35.060 ISBN 978-2-8322-3684-0
– i – IEEE Std 1636.1-2013
Contents
1. Overview . 1
1.1 Scope . 2
1.2 Purpose . 2
1.3 Application . 2
1.4 Precedence. 3
1.5 Conventions used in this document . 3
2. Normative references. 4
3. Definitions, acronyms, and abbreviations . 4
3.1 Definitions . 4
3.2 Acronyms and abbreviations . 5
4. Test results and session information. 6
4.1 Background. 6
4.2 Introduction . 6
4.3 Applicability . 6
4.4 Usage . 7
4.5 Relationships to other automatic test system (ATS) architectural elements. 7
5. EXPRESS model, EXPRESS-G diagram, and XML schema names and locations . 9
6. Conformance . 10
7. Extensibility. 11
Annex A (normative) XML schemas . 12
A.1 TestResults.xsd . 12
A.2 TestResultsCollection.xsd. 59
Annex B (normative) EXPRESS models . 60
B.1 TEST_RESULTS_MODEL. 60
B.2 TestResults model EXPRESS-G diagrams . 76
Annex C (informative) Bibliography. 83
Annex D (informative) IEEE list of participants.85
viii
IEEE Std 1636.1-2013 – ii –
SOFTWARE INTERFACE
FOR MAINTENANCE INFORMATION COLLECTION
AND ANALYSIS (SIMICA):
EXCHANGING TEST RESULTS AND SESSION
INFORMATION VIA THE EXTENSIBLE MARKUP
LANGUAGE (XML)
)25(:25'
7KH,QWHUQDWLRQDO(OHFWURWHFKQLFDO&RPPLVVLRQ,(&LVDZRUOGZLGHRUJDQL]DWLRQIRUVWDQGDUGL]DWLRQFRPSULVLQJ
DOO QDWLRQDO HOHFWURWHFKQLFDO FRPPLWWHHV ,(& 1DWLRQDO &RPPLWWHHV7KHREMHFWRI,(&LVWRSURPRWH
LQWHUQDWLRQDOFRRSHUDWLRQRQDOOTXHVWLRQVFRQFHUQLQJVWDQGDUGL]DWLRQLQWKHHOHFWULFDODQGHOHFWURQLFILHOGV7R
WKLVHQGDQGLQDGGLWLRQWRRWKHUDFWLYLWLHV,(&SXEOLVKHV,QWHUQDWLRQDO6WDQGDUGV7HFKQLFDO6SHFLILFDWLRQV
7HFKQLFDO 5HSRUWV 3XEOLFO\ $YDLODEOH 6SHFLILFDWLRQV 3$6 DQG *XLGHV KHUHDIWHU UHIHUUHG WR DV ³,(&
3XEOLFDWLRQV´7KHLUSUHSDUDWLRQLVHQWUXVWHGWRWHFKQLFDOFRPPLWWHHVDQ\,(&1DWLRQDO&RPPLWWHHLQWHUHVWHG
LQ WKH VXEMHFW GHDOW ZLWK PD\ SDUWLFLSDWH LQ WKLV SUHSDUDWRU\ ZRUN ,QWHUQDWLRQDO JRYHUQPHQWDO DQG QRQ
JRYHUQPHQWDORUJDQL]DWLRQVOLDLVLQJZLWKWKH,(&DOVRSDUWLFLSDWHLQWKLVSUHSDUDWLRQ
,(((6WDQGDUGVGRFXPHQWVDUHGHYHORSHGZLWKLQ,(((6RFLHWLHVDQG6WDQGDUGV&RRUGLQDWLQJ&RPPLWWHHVRIWKH
,(((6WDQGDUGV$VVRFLDWLRQ,(((6$6WDQGDUGV%RDUG,(((GHYHORSVLWVVWDQGDUGVWKURXJKDFRQVHQVXV
GHYHORSPHQWSURFHVVZKLFKEULQJVWRJHWKHUYROXQWHHUVUHSUHVHQWLQJYDULHGYLHZSRLQWVDQGLQWHUHVWVWRDFKLHYH
WKHILQDOSURGXFW9ROXQWHHUVDUHQRWQHFHVVDULO\PHPEHUVRI,(((DQGVHUYHZLWKRXWFRPSHQVDWLRQ:KLOH,(((
DGPLQLVWHUVWKHSURFHVVDQGHVWDEOLVKHVUXOHVWRSURPRWHIDLUQHVVLQWKHFRQVHQVXVGHYHORSPHQWSURFHVV,(((
GRHV QRW LQGHSHQGHQWO\ HYDOXDWH WHVW RU YHULI\ WKH DFFXUDF\ RI DQ\ RI WKH LQIRUPDWLRQ FRQWDLQHG LQ LWV
VWDQGDUGV8VHRI,(((6WDQGDUGVGRFXPHQWVLVZKROO\YROXQWDU\,(((GRFXPHQWVDUHPDGHDYDLODEOHIRUXVH
VXEMHFWWRLPSRUWDQWQRWLFHVDQGOHJDOGLVFODLPHUVVHHKWWSVWDQGDUGVLHHHRUJ,35GLVFODLPHUVKWPOIRUPRUH
LQIRUPDWLRQ
,(&FROODERUDWHVFORVHO\ZLWK,(((LQDFFRUGDQFHZLWKFRQGLWLRQVGHWHUPLQHGE\DJUHHPHQWEHWZHHQWKHWZR
RUJDQL]DWLRQV
7KHIRUPDOGHFLVLRQVRI,(&RQWHFKQLFDOPDWWHUVH[SUHVVDVQHDUO\DVSRVVLEOHDQLQWHUQDWLRQDOFRQVHQVXVRI
RSLQLRQRQWKHUHOHYDQWVXEMHFWVVLQFHHDFKWHFKQLFDOFRPPLWWHHKDVUHSUHVHQWDWLRQIURPDOOLQWHUHVWHG,(&
1DWLRQDO&RPPLWWHHV7KHIRUPDOGHFLVLRQVRI,(((RQWHFKQLFDOPDWWHUVRQFHFRQVHQVXVZLWKLQ,(((6RFLHWLHV
DQG6WDQGDUGV&RRUGLQDWLQJ&RPPLWWHHVKDVEHHQUHDFKHGLVGHWHUPLQHGE\DEDODQFHGEDOORWRIPDWHULDOO\
LQWHUHVWHG SDUWLHV ZKR LQGLFDWH LQWHUHVW LQ UHYLHZLQJ WKH SURSRVHG VWDQGDUG )LQDO DSSURYDO RI WKH ,(((
VWDQGDUGVGRFXPHQWLVJLYHQE\WKH,(((6WDQGDUGV$VVRFLDWLRQ,(((6$6WDQGDUGV%RDUG
,(&,((( 3XEOLFDWLRQV KDYH WKH IRUP RI UHFRPPHQGDWLRQV IRU LQWHUQDWLRQDO XVH DQG DUH DFFHSWHG E\ ,(&
1DWLRQDO&RPPLWWHHV,(((6RFLHWLHVLQWKDWVHQVH:KLOHDOOUHDVRQDEOHHIIRUWVDUHPDGHWRHQVXUHWKDWWKH
WHFKQLFDOFRQWHQWRI,(&,(((3XEOLFDWLRQVLVDFFXUDWH,(&RU,(((FDQQRWEHKHOGUHVSRQVLEOHIRUWKHZD\LQ
ZKLFKWKH\DUHXVHGRUIRUDQ\PLVLQWHUSUHWDWLRQE\DQ\HQGXVHU
,QRUGHUWRSURPRWHLQWHUQDWLRQDOXQLIRUPLW\,(&1DWLRQDO&RPPLWWHHVXQGHUWDNHWRDSSO\,(&3XEOLFDWLRQV
LQFOXGLQJ,(&,(((3XEOLFDWLRQVWUDQVSDUHQWO\WRWKHPD[LPXPH[WHQWSRVVLEOHLQWKHLUQDWLRQDODQGUHJLRQDO
SXEOLFDWLRQV$Q\GLYHUJHQFHEHWZHHQDQ\,(&,(((3XEOLFDWLRQDQGWKHFRUUHVSRQGLQJQDWLRQDORUUHJLRQDO
SXEOLFDWLRQVKDOOEHFOHDUO\LQGLFDWHGLQWKHODWWHU
,(&DQG,(((GRQRWSURYLGHDQ\DWWHVWDWLRQRIFRQIRUPLW\,QGHSHQGHQWFHUWLILFDWLRQERGLHVSURYLGHFRQIRUPLW\
DVVHVVPHQWVHUYLFHVDQGLQVRPHDUHDVDFFHVVWR,(&PDUNVRIFRQIRUPLW\,(&DQG,(((DUHQRWUHVSRQVLEOH
IRUDQ\VHUYLFHVFDUULHGRXWE\LQGHSHQGHQWFHUWLILFDWLRQERGLHV
$OOXVHUVVKRXOGHQVXUHWKDWWKH\KDYHWKHODWHVWHGLWLRQRIWKLVSXEOLFDWLRQ
1ROLDELOLW\VKDOODWWDFKWR,(&RU,(((RUWKHLUGLUHFWRUVHPSOR\HHVVHUYDQWVRUDJHQWVLQFOXGLQJLQGLYLGXDO
H[SHUWVDQGPHPEHUVRIWHFKQLFDOFRPPLWWHHVDQG,(&1DWLRQDO&RPPLWWHHVRUYROXQWHHUVRI,(((6RFLHWLHV
DQGWKH6WDQGDUGV&RRUGLQDWLQJ&RPPLWWHHVRIWKH,(((6WDQGDUGV$VVRFLDWLRQ,(((6$6WDQGDUGV%RDUG
IRUDQ\SHUVRQDOLQMXU\SURSHUW\GDPDJHRURWKHUGDPDJHRIDQ\QDWXUHZKDWVRHYHUZKHWKHUGLUHFWRULQGLUHFW
RUIRUFRVWVLQFOXGLQJOHJDOIHHVDQGH[SHQVHVDULVLQJRXWRIWKHSXEOLFDWLRQXVHRIRUUHOLDQFHXSRQWKLV
,(&,(((3XEOLFDWLRQRUDQ\RWKHU,(&RU,(((3XEOLFDWLRQV
$WWHQWLRQLVGUDZQWRWKHQRUPDWLYHUHIHUHQFHVFLWHGLQWKLVSXEOLFDWLRQ8VHRIWKHUHIHUHQFHGSXEOLFDWLRQVLV
LQGLVSHQVDEOHIRUWKHFRUUHFWDSSOLFDWLRQRIWKLVSXEOLFDWLRQ
$WWHQWLRQ LV GUDZQ WR WKH SRVVLELOLW\ WKDW LPSOHPHQWDWLRQ RI WKLV ,(&,((( 3XEOLFDWLRQ PD\ UHTXLUH XVH RI
PDWHULDOFRYHUHGE\SDWHQWULJKWV%\SXEOLFDWLRQRIWKLVVWDQGDUGQRSRVLWLRQLVWDNHQZLWKUHVSHFWWRWKH
H[LVWHQFHRUYDOLGLW\RIDQ\SDWHQWULJKWVLQFRQQHFWLRQWKHUHZLWK,(&RU,(((VKDOOQRWEHKHOGUHVSRQVLEOHIRU
LGHQWLI\LQJ(VVHQWLDO3DWHQW&ODLPVIRUZKLFKDOLFHQVHPD\EHUHTXLUHGIRUFRQGXFWLQJLQTXLULHVLQWRWKHOHJDO
YDOLGLW\ RU VFRSH RI 3DWHQW &ODLPV RU GHWHUPLQLQJ ZKHWKHU DQ\ OLFHQVLQJ WHUPV RU FRQGLWLRQV SURYLGHG LQ
FRQQHFWLRQZLWKVXEPLVVLRQRID/HWWHURI$VVXUDQFHLIDQ\RULQDQ\OLFHQVLQJDJUHHPHQWVDUHUHDVRQDEOHRU
QRQGLVFULPLQDWRU\8VHUVRIWKLVVWDQGDUGDUHH[SUHVVO\DGYLVHGWKDWGHWHUPLQDWLRQRIWKHYDOLGLW\RIDQ\SDWHQW
ULJKWVDQGWKHULVNRILQIULQJHPHQWRIVXFKULJKWVLVHQWLUHO\WKHLURZQUHVSRQVLELOLW\
– iii – IEEE Std 1636.1-2013
,QWHUQDWLRQDO 6WDQGDUG ,(& ,((( 6WG KDV EHHQ SURFHVVHG WKURXJK ,(&
WHFKQLFDOFRPPLWWHH(OHFWURQLFVDVVHPEO\WHFKQRORJ\XQGHUWKH,(&,((('XDO/RJR
$JUHHPHQW
7KHWH[WRIWKLVVWDQGDUGLVEDVHGRQWKHIROORZLQJGRFXPHQWV
,(((6WG )',6 5HSRUWRQYRWLQJ
)',6 59'
)XOOLQIRUPDWLRQRQWKHYRWLQJIRUWKHDSSURYDORIWKLVVWDQGDUGFDQEHIRXQGLQWKHUHSRUWRQ
YRWLQJLQGLFDWHGLQWKHDERYHWDEOH
7KH,(&7HFKQLFDO&RPPLWWHHDQG,(((7HFKQLFDO&RPPLWWHHKDYHGHFLGHGWKDWWKHFRQWHQWV
RIWKLVSXEOLFDWLRQZLOOUHPDLQXQFKDQJHGXQWLOWKHVWDELOLW\GDWHLQGLFDWHGRQWKH,(&ZHEVLWH
XQGHUKWWSZHEVWRUHLHFFKLQWKHGDWDUHODWHGWRWKHVSHFLILFSXEOLFDWLRQ$WWKLVGDWHWKH
SXEOLFDWLRQZLOOEH
‡ UHFRQILUPHG
‡ ZLWKGUDZQ
‡ UHSODFHGE\DUHYLVHGHGLWLRQRU
‡ DPHQGHG
IEEE Std 1636.1-2013 – iv –
IEEE Standard for Software Interface
for Maintenance Information Collection
and Analysis (SIMICA):
Exchanging Test Results and Session
Information via the eXtensible Markup
Language (XML)
Sponsor
IEEE Standards Coordinating Committees on
Test and Diagnosis for Electronic Systems (SCC20)
Approved 23 August 2013
IEEE-SA Standards Board
– v – IEEE Std 1636.1-2013
Abstract: This standard is intended to promote and facilitate interoperability between
components of automatic test systems where test results need to be shared. The standard thus
facilitates the capture of test results data in storage devices and databases, facilitating online and
offline analysis. The test results schema becomes a class of information that can be used within
the SIMICA family of standards. The exchange format utilizes the XML formats.
Keywords: automated test system (ATS), eXtensible markup language (XML), IEEE 1636.1™,
session information, Software Interface for Maintenance Information Collection and Analysis
(SIMICA), test results, XML schema
IEEE Std 1636.1-2013 – vi –
IEEE Introduction
This introduction is not part of IEEE Std 1636.1™-2013, IEEE Standard for Software Interface for Maintenance
Information Collection and Analysis (SIMICA): Exchanging Test Results and Session Information via the eXtensible
Markup Language (XML).
Maintainers of complex systems require the ability to capture and share test result information in a way that
supports such activities as performance analysis, post-production product improvement, maintenance
process improvement, and diagnostic maturation. Principal stakeholders of this project include but are not
limited to maintenance organizations within various Departments/Ministries of Defense, the commercial
airlines, the automotive industry, and the telecommunications industry. This standard is being developed as
a component of the IEEE 1636™ Software Interface for Maintenance Information Collection and Analysis
(SIMICA) project. SIMICA’s purpose is to specify a software interface for access, exchange, and analysis
of product diagnostic and maintenance information. Clause 4, Test results and session information,
provides a subset of the data needed to satisfy SIMICA requirements.
The use of formal information models will facilitate exchanging historical test results between information
systems and analysis tools. The models will facilitate creating open system software architectures for
maturing system diagnostics.
The XML schema described in this standard where appropriate utilizes and references components of the
IEEE Std 1671™ schema set.
It is anticipated that these schemas will be used throughout industries that utilize diagnostic and
maintenance data as an exchange format that can be understood by humans or machines. In order to ensure
wide acceptance throughout the user community, the schemas have been designed to encompass a broad
range of use cases. To accommodate use cases beyond the released design, the schemas provide means for
user extensibility.
It is anticipated that the IEEE Std 1636.1 schema will be used throughout the automatic test equipment
(ATE) industry as an exchange format that can be understood by humans or machines. In order to ensure
wide acceptance throughout the user community, the schemas have been designed to encompass a broad
range of use cases.
vii
– vii – IEEE Std 1636.1-2013
IEEE Std 1636.1-2013 – 1 –
Software Interface
for Maintenance Information Collection
and Analysis (SIMICA):
Exchanging Test Results and Session
Information via the eXtensible Markup
Language (XML)
IMPORTANT NOTICE: IEEE Standards documents are not intended to ensure safety, security, health,
or environmental protection, or ensure against interference with or from other devices or networks.
Implementers of IEEE Standards documents are responsible for determining and complying with all
appropriate safety, security, environmental, health, and interference protection practices and all
applicable laws and regulations.
This IEEE document is made available for use subject to important notices and legal disclaimers.
These notices and disclaimers appear in all publications containing this document and may
be found under the heading “Important Notice” or “Important Notices and Disclaimers
Concerning IEEE Documents.” They can also be obtained on request from IEEE or viewed at
http://standards.ieee.org/IPR/disclaimers.html.
1. Overview
The XML schema and EXPRESS model described in this document are intended for the recording of the
history of the execution and observations from a test or test session. This information includes results data
directly generated by test equipment or by the test equipment operating software. The combination of this
information will aid in the improvement of the test process.
The XML schema associated with this standard is based on World Wide Web Consortium (W3C) XML
eXtensible Markup Language (XML) 1.0 Proposed Edited Recommendation [B1].
The EXPRESS model associated with this standard is based on ISO 10303-11:1994 [B9].
W3C is a registered trademark of the World Wide Web Consortium.
Information on references can be found in Annex C.
– 2 – IEEE Std 1636.1-2013
IEEE Std 1636.1-2013
IEEE Standard for Software Interface for Maintenance Information Collection and Analysis (SIMICA):
Exchanging Test Results and Session Information via the eXtensible Markup Language (XML)
1.1 Scope
The scope of this standard is the definition of an exchange format, utilizing XML, for exchanging data
resulting from executing tests of a unit under test (UUT) via a test program in an automatic test
environment. The standard uses the information models of IEEE Std 1636™-2009 as a foundation.
1.2 Purpose
The purpose of this standard is to specify a software interface for access, exchange, and analysis of test
result information. The standard enables the capture of test results data, facilitating data analysis to assess
the effectiveness of test and diagnostic processes applied to complex systems. The test results information
model and XML schema define the semantics and exchange format for information to be used among
applications implementing the SIMICA family of standards.
1.3 Application
1.3.1 Of this document
This document provides formal specifications of the information required for the development of shared
maintenance data and the results of testing. These are applicable to both the SIMICA family of standards
and the ATML family of standards.
Anticipated users of this standard include the following:
a) System developers
b) System maintainers
c) Test program set (TPS) developers
d) TPS maintainers
e) Automatic test equipment (ATE) system developers
f) ATE system maintainers
g) Test instrument developers
1.3.2 Of this document’s annexes
This document includes three annexes. Of these three, two are normative (Annex A and Annex B).
Annex A contains the description of each of the XML schema elements and types.
Annex B contains the description of the EXPRESS and EXPRESS-G model elements.
Annex C is informative, and thus are provided strictly as information, for both users and maintainers of this
document.
Information on references can be found in Clause 2.
IEEE Std 1636.1-2013 – 3 –
IEEE Std 1636.1-2013
IEEE Standard for Software Interface for Maintenance Information Collection and Analysis (SIMICA):
Exchanging Test Results and Session Information via the eXtensible Markup Language (XML)
1.4 Precedence
In the event of conflict between this document and an SIMICA family component standard, this document
shall take precedence.
In the event of conflict between this document and a normatively referenced standard (See Clause 2), the
normatively referenced standard, as it applies to the information being produced, shall take precedence.
In the event of conflict between this document’s EXPRESS model definition and/or annotations and this
document’s XML schema definition and/or annotations, this document’s EXPRESS model definition
and/or annotations, as it applies to the information being produced, shall take precedence.
In the event of conflict between this document’s EXPRESS model definition and/or annotations and an
SIMICA family component standard and/or EXPRESS model, this document’s EXPRESS model definition
and/or annotations, as it applies to the information being produced, shall take precedence.
In the event of conflict between this document’s XML schema definition and/or annotations and an
SIMICA family component standard and/or XML schemas, this document’s XML schema definition and/or
annotations, as it applies to the information being produced, shall take precedence.
In the event of conflict between this document’s XML schema definition and/or annotations and the ATML
Common XML schema, this document’s XML schema definition and/or annotations, as it applies to the
information being produced, shall take precedence.
1.5 Conventions used in this document
1.5.1 General
All simple, complex types attribute groups and elements will be listed; explanatory information will be
provided, along with examples if additional clarification is needed. The explanatory information shall
include information on the intended use of the elements and/or attributes where the name of the entity does
not clearly indicate its intended use. For elements derived from another source type (e.g., an abstract type),
only attributes which extend the source type shall be listed; details regarding the base type shall be listed
along with the base type.
The namespace prefix “c:” identifies that the type or attribute group is contained in Annex B of IEEE Std
TM
1671 (Schema-Common.xsd).
When referring to an attribute of an XML element, the convention of [element]@[attribute] shall be used.
In cases where an attribute name is referred to with no associated element, the attribute name shall be
enclosed in single quotes.
In tables that describe XML elements, the column “Use” indicates the occurrence constraints for each
element.
a) “Required” indicates that the element shall appear exactly once.
b) “Optional” indicates that the element may appear once or not at all.
c) “1.’” indicates that the element shall appear at least once and may appear multiple times.
d) “0.’” indicates that the element may appear multiple times, once, or not at all.
– 4 – IEEE Std 1636.1-2013
IEEE Std 1636.1-2013
IEEE Standard for Software Interface for Maintenance Information Collection and Analysis (SIMICA):
Exchanging Test Results and Session Information via the eXtensible Markup Language (XML)
All specifications for the EXPRESS language are given in the Courier type font which includes
references to entity and attribute names in the supporting text.
1.5.2 Word usage
In this document, the word shall is used to indicate a mandatory requirement. The word should is used to
indicate a recommendation. The word may is used to indicate a permissible action. The word can is used
for statements of possibility and capability.
2. Normative references
The following referenced documents are indispensable for the application of this document (i.e., they must
be understood and used, so each referenced document is cited in text and its relationship to this document is
explained). For dated references, only the edition cited applies. For undated references, the latest edition of
the referenced document (including any amendments or corrigenda) applies.
IEEE Std 1636™-2009, IEEE Trial-Use Standard for Software Interface for Maintenance Information
4, 5
Collection and Analysis (SIMICA).
IEEE 1636.99™-2013, IEEE Standard for Software Interface for Maintenance Information Collection and
Analysis (SIMICA): Common Information Elements.
IEEE Std.1671™-2010, IEEE Standard for Automatic Test Markup Language (ATML) for Exchanging
Automatic Test Equipment and Test Information via XML.
3. Definitions, acronyms, and abbreviations
For the purposes of this document, the following terms and definitions apply. The IEEE Standards
Dictionary Online [B2] should be consulted for terms not defined in this clause.
3.1 Definitions
branch: In an eXtensible Markup Language (XML) document or schema, a specified element and all
elements subordinate to that specified element.
component (in eXtensible Markup Language (XML) schema): The generic term for the building blocks
that compose the abstract data model of the schema.
eXtensible Markup Language (XML) attribute: Name-value pair associated with an XML element.
eXtensible Markup Language (XML) document: A (text) data object that conforms to the XML
requirements for being well-formed (as defined by W3C).
IEEE publications are available from The Institute of Electrical and Electronics Engineers (http://standards.ieee.org/).
The IEEE standards or products referred to in this clause are trademarks of The Institute of Electrical and Electronics Engineers, Inc.
IEEE Standards Dictionary Online subscription is available at:
http://www.ieee.org/portal/innovate/products/standard/standards_dictionary.html
IEEE Std 1636.1-2013 – 5 –
IEEE Std 1636.1-2013
IEEE Standard for Software Interface for Maintenance Information Collection and Analysis (SIMICA):
Exchanging Test Results and Session Information via the eXtensible Markup Language (XML)
eXtensible Markup Language (XML) namespace: A method for distinguishing XML elements and
attributes that may have the same name but different meanings. A URL is used as a prefix to a “local
name.” This combination ensures the uniqueness of the element or attribute name. The URL is used only as
a way to create a unique prefix and does not have to resolve to a real page on the Internet.
NOTE—See Namespaces in XML 1.0 [B10] and Schenk and Wilson [B11] .
eXtensible Markup Language (XML) schema: The structure or framework used to define a data record.
This includes each field’s name, type, shape, dimension, and mapping.
framework: A framework is a real or conceptual structure expressed as a set of abstract classes. The
framework provides a context for the components to be used.
instance document: A textual information set grouped for some purpose that is governed by a single XML
schema.
maintenance: Activity intended to keep equipment (hardware) or programs (software) in satisfactory
working condition, including replacements, adjustments, repairs, software/firmware updates, and program
improvements. Maintenance can be preventative or corrective. (Adapted from MIL-STD-1309D [B12].)
particle (in eXtensible Markup Language (XML) schema): A kind of component.
qualified name (in XML schema): The complete name of an XML element, attribute, or data type,
including the local name and a prefix that identifies the namespace in which the local name is
defined/declared.
sequence (in XML schema): A compositor for model group schema components which specifies that
subordinate elements in an instance document must correspond, in order, to the specified particles.
3.2 Acronyms and abbreviations
AI-ESTATE Artificial Intelligence Exchange and Service Tie to All Test Environments
ATE automatic test equipment
ATML Automatic Test Markup Language
ATS automatic test system
DMC Diagnostic and Maintenance Control
ISO International Organization for Standardization
MAI maintenance action information
SCC20 Standards Coordinating Committee 20
SIMICA Software Interface for Maintenance Information Collection and Analysis
TPS test program set
UUT unit under test
Notes in text, tables, and figures are given for information only and do not contain requirements needed to implement the standard.
– 6 – IEEE Std 1636.1-2013
IEEE Std 1636.1-2013
IEEE Standard for Software Interface for Maintenance Information Collection and Analysis (SIMICA):
Exchanging Test Results and Session Information via the eXtensible Markup Language (XML)
URL universal resource locator
W3C World Wide Web Consortium
XML eXtensible Markup Language
4. Test results and session information
4.1 Background
Current automatic test system architectures are implemented with tight coupling between components. This
tight coupling inhibits interoperability by requiring components of the automatic test system to be
developed specific to that particular architecture. In many cases, this coupling can be reduced by
developing the components that operate relative to standard interfaces.
This document will facilitate accomplishing several objectives. First, the document will serve as a single
source for specifying essential test data with data elements related to the unit under test (UUT), the test
station, and the test program. Second, the document will assist the automatic test equipment (ATE) industry
to design and create compatible, interoperable tool sets such as data parsers and writers. Third, the standard
will assist ATE users of such data (e.g., automotive, semiconductor, aerospace, and military) to process and
display test results across a variety of systems.
This document has been developed as a “component standard” under IEEE Std 1636. SIMICA’s purpose is
to specify software interfaces for access, exchange, and analysis of product diagnostic and maintenance
information. Test results provide a subset of the data needed to satisfy SIMICA’s requirements.
This document also represents the test results component of IEEE Std 1671 (ATML). In defining its overall
architecture, ATML references include both IEEE Std 1636 (SIMICA) and IEEE Std 1636.1 (this
standard).
4.2 Introduction
This document’s XML schema and EXPRESS model provides a standard format for the transport of both
quantitative (measured values) and qualitative (pass/fail determination) test results. The design is such that
it is possible to store ancillary information such as environmental conditions and system/operator messages.
This information, although not specifically “results,” is intended to permit use of an instance document for
a variety of purposes, including statistical analysis and diagnostics. Some examples of this ancillary
information include identifying information for the UUT, the test station, and the test program; ambient
environmental conditions at the time of the test; test equipment calibration data; as well as test program
input data and ancillary textual comments. This document establishes a hierarchical structure for results
data to permit the grouping of a series of related test results in a single instance document.
4.3 Applicability
This document will permit test results data to be shared for a variety of purposes, including statistical
analysis, diagnostics, and improvement of the unit under test (UUT) repair process.
IEEE Std 1636.1-2013 – 7 –
IEEE Std 1636.1-2013
IEEE Standard for Software Interface for Maintenance Information Collection and Analysis (SIMICA):
Exchanging Test Results and Session Information via the eXtensible Markup Language (XML)
4.4 Usage
This document presumes some knowledge of XML and the use of XML schemas. A variety of XML
software tools are available in a number of computer programming languages. This document makes no
presumption regarding the tool(s) being used or the specific test system(s) generating the test result
information being captured in an XML instance document.
This document describes the TestResults.xsd schema and specifies the EXPRESS information model that
conformant instance documents must follow. In general, this document serves as an enhancement to the
annotations provided within the XML schema and EXPRESS model files.
4.4.1 XML schema representations
Within the body of this document, unless otherwise indicated, all syntax references relate to XML. Refer to
XML eXtensible Markup Language (XML) 1.0 [B1] for detailed descriptions of XML data formats.
4.4.2 EXPRESS/EXPRESS-G representations
This document also uses the EXPRESS information modeling language to represent the information
contained in the XML schema in a way that supports alternative exchange mechanisms and better defines
the semantics of the elements of the XML schema. The information models are presented in a lexical form
(EXPRESS) as well as in graphical form (EXPRESS-G) to facilitate understanding. The EXPRESS
language is defined by ISO 10303-11:1994 [B9].
4.5 Relationships to other automatic test system (ATS) architectural elements
4.5.1 General
In the ATS context, a test is a procedure for evaluating or quantifying the operation of some device or
system. The TestResults schema provides a standard format for the transport or storage of both quantitative
(measured values) and qualitative (pass/fail determination) test results. The XML schema design is such
that ancillary information such as environmental conditions and system/operator messages may also be
stored in an XML instance document. This information, while not specifically “results,” is intended to
permit use of an XML instance document for a variety of purposes, including statistical analysis and
diagnostics. Some examples of this ancillary information includes identifying information for the UUT, the
test station, and the test program; ambient environmental conditions at the time of the test; test equipment
calibration data; test program input data and ancillary textual comments. The structure of the schema
establishes a hierarchical structure for results data to permit the grouping of a series of related test results in
a single instance document.
4.5.2 ATML test description instance documents
Within the context of an ATS, a test is any procedure for evaluating or quantifying the operation of a UUT.
This test may be an implementation of an ATML test description XML instance document. In those cases
where the test is an implementation of an ATML test description XML instance document, the relationships
described in this clause apply.
The SIMICA test result can be qualitative (yes/no) or quantitative (a measured or calculated value). It can
be a personal observation or the output of an ATS.
– 8 – IEEE Std 1636.1-2013
IEEE Std 1636.1-2013
IEEE Standard for Software Interface for Maintenance Information Collection and Analysis (SIMICA):
Exchanging Test Results and Session Information via the eXtensible Markup Language (XML)
The SIMICA Test Results XML schema provides a standard format for exchanging and storing the
measured values, pass/fail results, and accompanying data (including test operator, station information, and
environmental conditions) associated with the test method implemented for the ATML Test Description
XML instance documents defined test(s).
ATS architecture shall maintain a direct correlation between the ATML test description and the SIMICA
test result. An example of this direct correlation is depicted by Figure 1.
Figure 1 —Direct relationship to a IEEE 1671.1 test description
Maintaining this direct correlation between the ATML test, the test method, and the SIMICA test results is
vital to all interested parties (engineering, contracts, etc.) to both understand and agree upon:
The methods of making measurements and,
The method of obtaining the data.
IEEE Std 1636.1-2013 – 9 –
IEEE Std 1636.1-2013
IEEE Standard for Software Interface for Maintenance Information Collection and Analysis (SIMICA):
Exchanging Test Results and Session Information via the eXtensible Markup Language (XML)
5. EXPRESS model, EXPRESS-G diagram, and XML schema names and
locations
The IEEE provides a download site for material published in association with IEEE Standards, presented in
machine friendly format. This material is digital rights management restricted use material. The SIMICA
family of standards utilizes this download site to allow easy accessibility to all of the SIMICA family
EXPRESS models and XML schemas (and in some cases, example XML instance documents). As depicted
by Figure 2, the IEEE download site (http://standards.ieee.org/downloads/) contains several folders, each
folder labeled by an associated IEEE standards number (e.g., IEEE 1636 standards are in the 1636 folder).
Each folder under the “base” IEEE standards number contains the material (XML schemas, etc) for that
family member. Family members are identified by their “dot” standard number (if it is a “dot” standard)
and the year in which that standard was published by the IEEE.
NOTE 1— Standards that are revised will contain a folder for the year in which the standard is reissued. Both folders
(for each year the standard was published) will be present on the IEEE download Web site.
NOTE 2— Providing a particular standard has associated material that is to be made available via the download Web
site, folders for that standard are not available until the standard is published by the IEEE.
Figure 2 depicts a portion of the IEEE download site, as it pertains to the SIMICA family of standards.
http://standards.ieee.org/downloads
1636/
1636 - 2009
1636 . 1 - 2007
1636 . 1 -2013
1636 . 2 - 2010
1636 . 99 - 2013
1671/
1671 - 2010
Figure 2 —SIMICA-related IEEE download site structure
– 10 – IEEE Std 1636.1-2013
IEEE Std 1636.1-2013
IEEE Standard for Software Interface for Maintenance Information Collection and Analysis (SIMICA):
Exchanging Test Results and Session Information via the eXtensible Markup Language (XML)
The IEEE Std 1636.1–associated XML schemas names, and the IEEE download site folder locations;
where each of the XML schemas shall be located, is as defined in Table 1. Where the IEEE Std 1636.1–
associated EXPRESS model shall be located, is as defined in Table 2.
Table 1 —IEEE Std 1636.1 XML schema names and folder locations
Component Defined in XML schema name IEEE download site folder (See Figure 2)
Test results and
Annex A.1 TestResults.xsd 1636/1636.1-2013
session information
Test results
Annex A.2 TestResultsCollection.xsd 1636/1636.1-2013
collection
Table 2 —IEEE Std 1636.1 EXPRESS model and diagram names and folder locations
Component Defined in EXPRESS model name IEEE download site folder (See Figure 2)
Test results and
session information Annex B.1 1636.1.exp 1636/1636.1-2013
model
The XML schemas identified in Table 1 includes the ATML common XML schema and the SIMICA
common XML schema. The XML schema name and the IEEE download site folder locations and where the
XML schemas shall be located is as defined in Table 3.
Table 3 —ATML and SIMICA common element XML schema names and locations
Component Defined in XML schema name IEEE download site folder
IEEE Std 1671-
ATML common Common.xsd 1671/1671-2010
2010 Annex B.1
IEEE Std 1636.99-
SIMICA common SIMICACommon.xsd 1636/1636.99-2013
2013 Annex A.1
6. Conformance
The minimal expectation for XML instance documents conformant with this document shall be that a
populated XML instance is considered valid if it complies with:
a) The Test Results XML schema (Defined in Annex A of this document, and available as described
in Clause 5)
b) The Test Results EXPRESS model (Defined in Annex B of this document, and available as
described in Clause 5)
c) The SIMICA Common XML schema (Defined in Annex A of IEEE Std 1636.99, and available as
described in Clause 5)
d) The ATML Common XML schema (Defined in Annex B.1 of IEEE Std 1671, and available as
described in Clause 5)
IEEE Std 1636.1-2013 – 11 –
IEEE Std 1636.1-2013
IEEE Standard for Software Interface for Maintenance Information Collection and Analysis (SIMICA):
Exchanging Test Results and Session Information via the eXtensible Markup Language (XML)
7. Extensibility
A provision in the XML schema of an extension mechanism is necessary to ensure the viability of the
specification and allow producers and consumers of SIMICA XML instance documents to interoperate in
those cases where there is a requirement to exchange relevant data that is not included in the
TestResults.xsd schema. The use of the extensions shall be done in a way that ensures that a conformant
consumer c
...




Questions, Comments and Discussion
Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.
Loading comments...