CLC/TR 60919-1:2005

6/29(16., 6,6773&/&75

67$1'$5'
MDQXDU
/DVWQRVWLYLVRNRQDSHWRVWQLKHQRVPHUQLKVLVWHPRY]YRGRYQRNRPXWLUDQLPL
SUHWYRUQLNLGHO3RJRMLYXVWDOMHQHPVWDQMX,(&75
LVWRYHWHQ&/&75
3HUIRUPDQFHRIKLJKYROWDJHGLUHFWFXUUHQW+9'&V\VWHPVZLWKOLQHFRPPXWDWHG
FRQYHUWHUV3DUW6WHDG\VWDWHFRQGLWLRQV,(&75
,&6 5HIHUHQþQDãWHYLOND

6,6773&/&75HQ
!"#$%&’( )&!*+,%- .
TECHNICAL REPORT CLC/TR 60919-1
RAPPORT TECHNIQUE
TECHNISCHER BERICHT December 2005

ICS 29.200; 29.240.99
English version
Performance of high-voltage direct current (HVDC) systems
with line-commutated converters
Part 1: Steady-state conditions
(IEC/TR 60919-1:2005)
Fonctionnement des systèmes à courant Betriebsverhalten netzgeführter
continu haute tension (CCHT) Stromrichter in Hochspannungs-
à convertisseurs commutés par le réseau gleichstrom (HGÜ)-Systemen
Partie 1: Spécification des conditions de Teil 1: Bedingungen im eingeschwungenen
fonctionnement en régime établi Zustand
(CEI/TR 60919-1:2005) (IEC 62102:2001)

This Technical Report was approved by CENELEC on 2005-07-09.

CENELEC members are the national electrotechnical committees of Austria, Belgium, Cyprus, Czech
Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia,
Lithuania, Luxembourg, Malta, Netherlands, Norway, Poland, Portugal, Slovakia, Slovenia, Spain, Sweden,
Switzerland and United Kingdom.

CENELEC
European Committee for Electrotechnical Standardization
Comité Européen de Normalisation Electrotechnique
Europäisches Komitee für Elektrotechnische Normung

Central Secretariat: rue de Stassart 35, B - 1050 Brussels

© 2005 CENELEC - All rights of exploitation in any form and by any means reserved worldwide for CENELEC members.

Ref. No. CLC/TR 60919-1:2005 E

Foreword
The text of the Technical Report IEC/TR 60919-1, prepared by SC 22F, Power electronics for
electrical transmission and distribution systems, of IEC TC 22, Power electronic systems and
equipment, was submitted to the formal vote and was approved by CENELEC as CLC/TR 60919-1 on
2005-07-09 without any modification.
Annex ZA has been added by CENELEC.
__________
Endorsement notice
The text of the Technical Report IEC/TR 60919-1:2005 was approved by CENELEC as a Technical
Report without any modification.
__________
- 3 - CLC/TR 60919-1:2005
Annex ZA
(normative)
Normative references to international publications
with their corresponding European publications
The following referenced documents are indispensable for the application of this document.
For dated references, only the edition cited applies. For undated references, the latest edition
of the referenced document (including any amendments) applies.
NOTE Where an international publication has been modified by common modifications, indicated by (mod), the relevant
EN/HD applies.
Publication Year Title EN/HD Year
IEC 60146-1-1 1991 Semiconductor convertors - General EN 60146-1-1 1993
+ A1 1996 requirements and line commutated + A1 1997
convertors
Part 1-1: Specifications of basic
requirements
IEC 60146-1-2 1991 Part 1-2: Application guide - -

IEC 60146-1-3 1991 Part 1-3: Transformers and reactors EN 60146-1-3 1993

IEC 60633 1998 Terminology for high-voltage direct EN 60633 1999
current (HVDC) transmission
IEC 61803 1999 Determination of power losses in high- EN 61803 1999
voltage direct current (HVDC) converter
stations
CISPR 16 series Specification for radio disturbance and EN 55016 series
immunity measuring apparatus and
methods
ISO 1996-1 2003 Acoustics – Description, measurement - -
and assessment of environmental noise
Part 1: Basic quantities and assessment
procedures
CIGRE Guide to the specification and design - -
Brochure No. 139 evaluation of AC filters for HVDC systems

CIGRE Protocol for reporting the operational - -
Report 14-97 performance of HVDC transmission
systems
TECHNICAL IEC
REPORT TR
60919-1
Second edition
2005-03
Performance of high-voltage direct current (HVDC)
systems with line-commutated converters –
Part 1: Steady-state conditions

 IEC 2005  Copyright - all rights reserved
No part of this publication may be reproduced or utilized in any form or by any means, electronic or
mechanical, including photocopying and microfilm, without permission in writing from the publisher.
International Electrotechnical Commission, 3, rue de Varembé, PO Box 131, CH-1211 Geneva 20, Switzerland
Telephone: +41 22 919 02 11 Telefax: +41 22 919 03 00 E-mail: inmail@iec.ch Web: www.iec.ch
PRICE CODE
Commission Electrotechnique Internationale
XC
International Electrotechnical Commission
Международная Электротехническая Комиссия
For price, see current catalogue

– 2 – TR 60919-1  IEC:2005(E)
CONTENTS
FOREWORD.6

1 Scope .8
2 Normative references .10
3 Types of HVDC systems .10
3.1 General .10
3.2 HVDC back-to-back system .11
3.3 Monopolar earth return HVDC system .12
3.4 Monopolar metallic return HVDC system .14
3.5 Bipolar earth return HVDC system.15
3.6 Bipolar metallic return HVDC system.18
3.7 Two 12-pulse groups per pole .20
3.8 Converter transformer arrangements.20
3.9 DC switching considerations .20
3.10 Series capacitor compensated HVDC systems .25
4 Environment information .27
5 Rated power, current and voltage .31
5.1 Rated power.31
5.2 Rated current .31
5.3 Rated voltage .32
6 Overload and equipment capability .32
6.1 Overload .32
6.2 Equipment capability.33
7 Minimum power transfer and no-load stand-by state .34
7.1 General .34
7.2 Minimum current.34
7.3 Reduced direct voltage operation .35
7.4 No-load stand-by state.35
8 AC system.36
8.1 General .36
8.2 AC voltage .36
8.3 Frequency .37
8.4 System impedance at fundamental frequency.38
8.5 System impedance at harmonic frequencies.38
8.6 Positive and zero-sequence surge impedance .38
8.7 Other sources of harmonics .38
8.8 Subsynchronous torsional interaction (SSTI) .38
9 Reactive power.39
9.1 General .39
9.2 Conventional HVDC systems .39
9.3 Series capacitor compensated HVDC schemes .41
9.4 Converter reactive power consumption.41

TR 60919-1  IEC:2005(E) – 3 –
9.5 Reactive power balance with the a.c. system.41
9.6 Reactive power supply.42
9.7 Maximum size of switchable VAR banks.42
10 HVDC transmission line, earth electrode line and earth electrode .42
10.1 General .42
10.2 Overhead line(s).43
10.3 Cable line(s).43
10.4 Earth electrode line .44
10.5 Earth electrode.44
11 Reliability .44
11.1 General .44
11.2 Outage .44
11.3 Capacity.45
11.4 Outage duration terms .45
11.5 Energy unavailability (EU).46
11.6 Energy availability (EA).47
11.7 Maximum permitted number of forced outages .47
11.8 Statistical probability of outages.47
12 HVDC control .48
12.1 Control objectives.48
12.2 Control structure.48
12.3 Control order settings .54
12.4 Current limits.54
12.5 Control circuit redundancy .55
12.6 Measurements.55
13 Telecommunication.55
13.1 Types of telecommunication links.55
13.2 Telephone .56
13.3 Power line carrier (PLC) .56
13.4 Microwave .56
13.5 Radio link .57
13.6 Optical fibre telecommunication .57
13.7 Classification of data to be transmitted.57
13.8 Fast response telecommunication .58
13.9 Reliability .58
14 Auxiliary power supplies .58
14.1 General .58
14.2 Reliability and load classification.59
14.3 AC auxiliary supplies .60
14.4 Batteries and uninterruptible power supplies (UP
...